Startseite>>Signaling Pathways>> Neuroscience>>Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) (Synonyms: NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2)

Katalog-Nr.GC52382

A peptide fragment of Nogo-A

Products are for research use only. Not for human use. We do not sell to patients.

Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt) Chemische Struktur

Größe Preis Lagerbestand Menge
1 mg
55,00 $
Auf Lager
5 mg
244,00 $
Auf Lager
10 mg
431,00 $
Auf Lager
25 mg
945,00 $
Auf Lager

Tel:(909) 407-4943 Email: sales@glpbio.com

Kundenbewertungen

Basiert auf Kundenrezensionen.

  • GlpBio Citations

    GlpBio Citations
  • Bioactive Compounds Premium Provider

    Bioactive Compounds Premium Provider

Sample solution is provided at 25 µL, 10mM.

Description Chemical Properties Product Documents Related Products

Nogo-66 (1-40) is a peptide fragment of Nogo-A that corresponds to the extracellular domain, Nogo-66, which can induce neurite growth cone collapse in oligodendrocytes.1,2 It is also an antagonist of the Nogo-66 receptor (NgR).2 It inhibits binding of the NgR agonist AP-Nogo-66 to, and inhibits growth cone collapse induced by the NgR agonist GST-Nogo-66 in, embryonic day 12 (E12) chick dorsal root ganglia (DRG) explants.2 Nogo-66 (1-40) partially reverses axonal outgrowth inhibition induced by purified CNS myelin in E12 chick DRG explants (EC50 = 50 nM). It also induces regeneration of corticospinal tract fibers and improves locomotor function in a rat model of midthoracic spinal cord hemisection injury when administered intrathecally at a dose of 75 µg/kg per day.

1.Lim, M., Shi, J., Wei, Z., et al.Structural characterization of the human Nogo-A functional domains. Solution structure of Nogo-40, a Nogo-66 receptor antagonist enhancing injured spinal cord regenerationEur. J. Biochem.271(17)3512-3522(2004) 2.GrandPrÉ, T., Li, S., and Strittmatter, S.M.Nogo-66 receptor antagonist peptide promotes axonal regenerationNature417(6888)547-551(2002)

Bewertungen

Review for Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

Average Rating: 5 ★★★★★ (Based on Reviews and 30 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.