NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
Katalog-Nr.GC61962 |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ ist ein mit dem Angiotensin-Converting-Enzym 2 (ACE2) verwandtes Peptid, das als Werkzeug zum VerstÄndnis der ACE2-Funktionen verwendet werden kann.
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Review for NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
Average Rating: 5
(Based on Reviews and 5 reference(s) in Google Scholar.)Review for NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *