Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) (Synonyms: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)) |
| Catalog No.GC46807 |
A neuropeptide with diverse biological activities
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: N/A
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
Adrenomedullin (1-52) is a peptide that corresponds to amino acids 1-52 of the porcine adrenomedullin sequence and contains a disulfide bond between cysteine residues at positions 16 and 21. It contains a glycine at position 40 instead of an asparagine residue as in the human adrenomedullin (1-52) sequence.1 It has been found in the porcine adrenal medulla cortex, pancreatic islet acinus and duct, and the anterior and posterior pituitary.2
1.Kitamura, K., Kangawa, K., Kojima, M., et al.Complete amino acid sequence of porcine adrenomedullin and cloning of cDNA encoding its precursorFEBS Lett.338(3)306-310(1994) 2.Washimine, H., Asada, Y., Kitamura, K., et al.Immunohistochemical identification of adrenomedullin in human, rat, and porcine tissueHistochem. Cell. Biol.103(4)251-254(1995)
Average Rating: 5 (Based on Reviews and 5 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *