Accueil>>Signaling Pathways>> GPCR/G protein>> Melanocortin (MC) Receptors>>Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA (Synonyms: ACTH (1-39) (mouse, rat) TFA)

Catalog No.GC35255

L'hormone adrénocorticotrope (ACTH) (1-39), de rat (TFA) est un puissant agoniste des récepteurs de la mélanocortine 2 (MC2).

Products are for research use only. Not for human use. We do not sell to patients.

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA Chemical Structure

Taille Prix Stock Qté
500μg
167,00 $US
En stock
1mg
260,00 $US
En stock
5mg
1 020,00 $US
En stock

Tel:(909) 407-4943 Email: sales@glpbio.com


Avis des clients

Based on customer reviews.

  • GlpBio Citations

    GlpBio Citations
  • Bioactive Compounds Premium Provider

    Bioactive Compounds Premium Provider

Sample solution is provided at 25 µL, 10mM.

Description of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist.

ACTH 1-39 at concentrations of 100-400 nM has no toxic effect on neurons, while ACTH provides protection from excitotoxic neuronal death induced by glutamate (100 μM), NMDA (1 mM), AMPA (50 μM), and kainate (25 μM). ACTH at 400 nM provides substantial protection in each case. ACTH at either 200 or 400 nM protects neurons from quinolinic acid (25 μM). There is also protection by ACTH from cell death induced by 2 μM H2O2, which gives rise to reactive oxygen species (ROS), with significantly more protection at 400 nM ACTH compared to 200 nM. ACTH gives modest protection against rapid release of nitric oxide (NO) by NOC-12 but not slow release by NOC-18. ACTH (200 or 400 nM) protects neurons from cytotoxic effects of staurosporine (10-20 nM), a classic inducer of cell death via apoptosis. ACTH reduces cell death from 80% to 55%[1].

The icv injection of ACTH significantly reduces cumulative food intake over the observation period compared with the saline/IgG group. The injection of ACTH Ab into the PVN abolishes the anorexigenic effect of ACTH. Infusion icv of ACTH significantly decreases cumulative food intake in rats that receive α-MSH Ab into the PVN and ACTH icv, and food intake is as low as in the group treated with ACTH icv and IgG into the PVN. Injection of either ACTH Ab or α-MSH Ab into the PVN significantly increase cumulative food intake compared with IgG-treated animals; the combined application of both Ab's do not increase food intake further[2].

[1]. Lisak RP, et al. Melanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage. Exp Neurol. 2015 Nov;273:161-7. [2]. Schulz C, et al. Endogenous ACTH, not only alpha-melanocyte-stimulating hormone, reduces food intake mediated by hypothalamic mechanisms. Am J Physiol Endocrinol Metab. 2010 Feb;298(2):E237-44.

Protocol of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Animal experiment:

Rats[2]Male Wistar rats (weight range 225-250 g at purchase) are used throughout the study. Animals receive a PVN application of ACTH Ab (2 μg/rat) or IgG (2 μg/rat); administration of either ACTH (1 nM/rat) or saline icv is performed 5 min later[2].

References:

[1]. Lisak RP, et al. Melanocortin receptor agonist ACTH 1-39 protects rat forebrain neurons from apoptotic, excitotoxic and inflammation-related damage. Exp Neurol. 2015 Nov;273:161-7.
[2]. Schulz C, et al. Endogenous ACTH, not only alpha-melanocyte-stimulating hormone, reduces food intake mediated by hypothalamic mechanisms. Am J Physiol Endocrinol Metab. 2010 Feb;298(2):E237-44.

Chemical Properties of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Cas No. SDF
Synonymes ACTH (1-39) (mouse, rat) TFA
Canonical SMILES FC(C(O)=O)(F)F.[SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF]
Formula C212H316F3N57O59S M.Wt 4696.18
Solubility DMSO : 100 mg/mL (Need ultrasonic); H2O : 100 mg/mL (Need ultrasonic) Storage Store at -20°C
General tips Please select the appropriate solvent to prepare the stock solution according to the solubility of the product in different solvents; once the solution is prepared, please store it in separate packages to avoid product failure caused by repeated freezing and thawing.Storage method and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored at -20°C, please use it within 1 month.
To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time.
Shipping Condition Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request.

Complete Stock Solution Preparation Table of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Prepare stock solution
1 mg 5 mg 10 mg
1 mM 0.2129 mL 1.0647 mL 2.1294 mL
5 mM 0.0426 mL 0.2129 mL 0.4259 mL
10 mM 0.0213 mL 0.1065 mL 0.2129 mL
  • Molarity Calculator

  • Dilution Calculator

  • Molecular Weight Calculator

Mass
=
Concentration
x
Volume
x
MW*
 
 
 
**When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and MSDS / CoA (available online).

Calculate

In vivo Formulation Calculator (Clear solution) of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

mg/kg g μL

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO % % Tween 80 % ddH2O
%DMSO %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

Product Documents

Quality Control & SDS

View current batch:

Avis

Review for Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Average Rating: 5 ★★★★★ (Based on Reviews and 16 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.