STIEEQAKTFLDKFNHEAEDLFYQSSLASWN |
Catalog No.GC61927 |
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, un peptide lié À l'enzyme de conversion de l'angiotensine 2 (ACE2), peut être utilisé pour étudier la fonction de l'ACE2.
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2[1].
References:
[1]. Robson B, et, al. COVID-19 Coronavirus spike protein analysis for synthetic vaccines, a peptidomimetic antagonist, and therapeutic drugs, and analysis of a proposed achilles' heel conserved region to minimize probability of escape mutations and drug resistance. Comput Biol Med. 2020 Jun;121:103749.
Average Rating: 5
(Based on Reviews and 26 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *