NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ |
Catalog No.GC61962 |
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ는 ACE2 기능을 이해하기 위한 도구로 사용할 수 있는 안지오텐신 전환 효소 2(ACE2) 관련 펩타이드입니다.
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Review for NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
Average Rating: 5
(Based on Reviews and 5 reference(s) in Google Scholar.)Review for NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *