LL-37 (trifluoroacetate salt) (Synonyms: CAP-18, hCAP-18, Cathelicidin, FALL-39) |
Catalog No.GC14377 |
LL 37은 37개의 아미노산 잔류물질을 포함하고 있으며, 처음 두 개의 루시인 잔류물질(L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37)은 주로 피부 세포와 중성 백혈구 내에서 발견된다.
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 154947-66-7
Sample solution is provided at 25 µL, 10mM.
LL 37은 37개의 아미노산 잔류물질을 포함하고 있으며, 처음 두 개의 루시인 잔류물질(L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37)은 주로 피부 세포와 중성 백혈구 내에서 발견된다.
체외 실험에서 4와 10 μ M LL-37 처리는 인간 골세포 유형의 MG63 세포의 수와 활성을 감소시켰다.[2] 체외 실험에서 1과 10 μg/mL LL-37을 사용하여 pMSCs를 사전 처리한 것은 세포 이동 능력에 영향을 미치지 않았다. 그러나 1 μg/mL LL-37을 사용하여 48시간 후 pMSCs의 이동 잠재력을 증가시켰다.[4] 체외 실험 연구는 1 µmol/L 밀도의 LL-37을 24시간 처리한 후, LL-37이 LPS 유도된 MCP-1 표현의 자극을 막는 것으로 나타났다. 이는 전사 및 단백질 수준 모두에서 분석되었으며, TLR(Toll 유사 수용체) 2 및 TLR4 전사 표현에는 영향을 미치지 않았다. 동시에, 0.1 및 1µmol/L LL-37을 60분 동안 PDL 세포에 처리한 것은 LL-37의 면역 반응성을 유도했다.[5]
체내 실험 연구에 따르면, 각 쥐에 2μg의 LL-37을 정맥 주사하여 CLP 혈중독성 쥐의 생존률을 용량에 따라 향상시켰다. LL-37은 더 높은 항균 잠재력을 가진 ectosome 수준을 개선하여 CLP 쥐의 세균 부하를 감소시켰다.[1] LL-37은 용량에 따라 (1, 3, 또는 10 10 μg/ml) 중성 유도 neutrophil에서 풀 ectosome를 방출했다. LL-37 주사를 통해 CLP 쥐에서 polymorphonuclear세포의 침습을 억제하고, 세균 부담과 염증 반응이 감소했다.[3]
References:
[1].Nagaoka I, et al. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int J Mol Sci. 2020 Aug 19;21(17):5973.
[2].Bankell E, et al. LL-37-induced caspase-independent apoptosis is associated with plasma membrane permeabilization in human osteoblast-like cells. Peptides. 2021 Jan;135:170432.
[3].Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.
[4].Oliveira-Bravo M, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016 Dec 30;7(1):189.
[5].Aidoukovitch A, et al. The host defense peptide LL-37 is internalized by human periodontal ligament cells and prevents LPS-induced MCP-1 production. J Periodontal Res. 2019 Dec;54(6):662-670.
Average Rating: 5
(Based on Reviews and 1 reference(s) in Google Scholar.)GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *