>>Peptides>>LL-37 (trifluoroacetate salt)

LL-37 (trifluoroacetate salt) (Synonyms: CAP-18, hCAP-18, Cathelicidin, FALL-39)

Catalog No.GC14377

LL 37은 37개의 아미노산 잔류물질을 포함하고 있으며, 처음 두 개의 루시인 잔류물질(L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37)은 주로 피부 세포와 중성 백혈구 내에서 발견된다.

Products are for research use only. Not for human use. We do not sell to patients.

LL-37 (trifluoroacetate salt) Chemical Structure

Cas No.: 154947-66-7

Size 가격 재고 수량
1mg
US$88.00
재고 있음
5mg
US$182.00
재고 있음

Tel:(909) 407-4943 Email: sales@glpbio.com


고객 리뷰

Based on customer reviews.

  • GlpBio Citations

    GlpBio Citations
  • Bioactive Compounds Premium Provider

    Bioactive Compounds Premium Provider

Sample solution is provided at 25 µL, 10mM.

Description Protocol Chemical Properties Product Documents Related Products

LL 37은 37개의 아미노산 잔류물질을 포함하고 있으며, 처음 두 개의 루시인 잔류물질(L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37)은 주로 피부 세포와 중성 백혈구 내에서 발견된다.

체외 실험에서 4와 10 μ M LL-37 처리는 인간 골세포 유형의 MG63 세포의 수와 활성을 감소시켰다.[2] 체외 실험에서 1과 10 μg/mL LL-37을 사용하여 pMSCs를 사전 처리한 것은 세포 이동 능력에 영향을 미치지 않았다. 그러나 1 μg/mL LL-37을 사용하여 48시간 후 pMSCs의 이동 잠재력을 증가시켰다.[4] 체외 실험 연구는 1 µmol/L 밀도의 LL-37을 24시간 처리한 후, LL-37이 LPS 유도된 MCP-1 표현의 자극을 막는 것으로 나타났다. 이는 전사 및 단백질 수준 모두에서 분석되었으며, TLR(Toll 유사 수용체) 2 및 TLR4 전사 표현에는 영향을 미치지 않았다. 동시에, 0.1 및 1µmol/L LL-37을 60분 동안 PDL 세포에 처리한 것은 LL-37의 면역 반응성을 유도했다.[5]

체내 실험 연구에 따르면, 각 쥐에 2μg의 LL-37을 정맥 주사하여 CLP 혈중독성 쥐의 생존률을 용량에 따라 향상시켰다. LL-37은 더 높은 항균 잠재력을 가진 ectosome 수준을 개선하여 CLP 쥐의 세균 부하를 감소시켰다.[1] LL-37은 용량에 따라 (1, 3, 또는 10 10 μg/ml) 중성 유도 neutrophil에서 풀 ectosome를 방출했다. LL-37 주사를 통해 CLP 쥐에서 polymorphonuclear세포의 침습을 억제하고, 세균 부담과 염증 반응이 감소했다.[3]

References:
[1].Nagaoka I, et al. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. Int J Mol Sci. 2020 Aug 19;21(17):5973.
[2].Bankell E, et al. LL-37-induced caspase-independent apoptosis is associated with plasma membrane permeabilization in human osteoblast-like cells. Peptides. 2021 Jan;135:170432.
[3].Kumagai Y, et al. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 Oct;26(7):565-579.
[4].Oliveira-Bravo M, et al. LL-37 boosts immunosuppressive function of placenta-derived mesenchymal stromal cells. Stem Cell Res Ther. 2016 Dec 30;7(1):189.
[5].Aidoukovitch A, et al. The host defense peptide LL-37 is internalized by human periodontal ligament cells and prevents LPS-induced MCP-1 production. J Periodontal Res. 2019 Dec;54(6):662-670.

리뷰

Review for LL-37 (trifluoroacetate salt)

Average Rating: 5 ★★★★★ (Based on Reviews and 1 reference(s) in Google Scholar.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
Review for LL-37 (trifluoroacetate salt)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.