UBE2D1 Human (GST) |
| Catalog No.GP29065 |
Ubiquitin-conjugating enzyme E2 D1; Stimulator of Fe transport; SFT; UBC4/5 homolog; UbcH5; Ubiquitin carrier protein D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1; SFT; UBC5A; UBCH5; UBCH5A
Products are for research use only. Not for human use. We do not sell to patients.
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | Source | Human |
| Phycical Appearance | A solution | Shipping Condition | Shipping with dry ice. |
| Synonyms | Ubiquitin-conjugating enzyme E2 D1; Stimulator of Fe transport; SFT; UBC4/5 homolog; UbcH5; Ubiquitin carrier protein D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1; SFT; UBC5A; UBCH5; UBCH5A | ||
| Amino Acid Sequence | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM | ||
| Formulation | Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerin, pH 7.5. | ||
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Average Rating: 5 (Based on Reviews and 30 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *