Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) (Synonyms: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge))

Name: Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)
Brand: GlpBio
SKU: GC46807
Availability: InStock
Rating: 5 (5 reviews)

Catalog No.GC46807

A neuropeptide with diverse biological activities

Products are for research use only. Not for human use. We do not sell to patients.

Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) Chemical Structure

Cas No.: N/A

Tamaño

Precio

Disponibilidad

Cantidad

1 mg

427,00 $

Disponible

Tel：(909) 407-4943 Email: sales@glpbio.com

Reseñas de cliente

Based on customer reviews.

Sample solution is provided at 25 µL, 10mM.

GlpBio Products Cited In Reputable Papers

Nature
610.7931 (2022): 366-372

Nature
618, 1017–1023 (2023)

Cell
183.7 (2020): 1867-1883

Cell Research
31, 1291–1307 (2021)

Cell Research
33, 273–287 (2023)

Cell Research
33, 546–561 (2023)

Molecular Cancer
21.1 (2022): 1-17

Molecular Cancer
21.1 (2022): 1-18

Cancer Cell
39 (2021): 1-16

Cell Host Microbe
30.8 (2022): 1124-1138

Cell Host Microbe
31.5 (2023): 766-780

Cell Host Microbe
31.3 (2023): 418-43

Cell Metabolism
34.2 (2022): 240-255

Ann Rheum Dis
82(4): 533-545 (2023)

Cell Mol Immunol
20, 264–276 (2023)

Adv Funct Mater
33.35 (2023): 2214998

Description Chemical Properties Product Documents

Product Documents

Quality Control & SDS

View current batch:

Purity: >95.00%

Adrenomedullin (1-52) is a peptide that corresponds to amino acids 1-52 of the porcine adrenomedullin sequence and contains a disulfide bond between cysteine residues at positions 16 and 21. It contains a glycine at position 40 instead of an asparagine residue as in the human adrenomedullin (1-52) sequence.¹ It has been found in the porcine adrenal medulla cortex, pancreatic islet acinus and duct, and the anterior and posterior pituitary.²

1.Kitamura, K., Kangawa, K., Kojima, M., et al.Complete amino acid sequence of porcine adrenomedullin and cloning of cDNA encoding its precursorFEBS Lett.338(3)306-310(1994) 2.Washimine, H., Asada, Y., Kitamura, K., et al.Immunohistochemical identification of adrenomedullin in human, rat, and porcine tissueHistochem. Cell. Biol.103(4)251-254(1995)

Cas No.	N/A	SDF
Sinónimos	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)
Canonical SMILES	O=C(O)C(F)(F)F.[H]N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CC(N)=O)C(N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CO)C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(NCC(N[C@]([C@@H](C)O)([H])C1=O)=O)=O)CC2=CC=CC=C2)=O)=O)CSSC[C@H](N1)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](C(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@]([C@H](CC)C)([H])C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@H](C(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N[C@@H](CCCCN)C(N[C@H](C(N[C@@H](CCCCN)C(N[C@H](C(NCC(N[C@@H](C(C)C)C(N[C@H](C(N3CCC[C@H]3C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@]([C@H](CC)C)([H])C(N[C@@H](CO)C(N4CCC[C@H]4C(N[C@@H](CCC(N)=O)C(NCC(N[C@H](C(N)=O)CC5=CC=C(O)C=C5)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)CC(O)=O)=O)=O)CC(O)=O)=O)=O)CC(O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)CC7=CC=C(O)C=C7)=O)=O)=O)CC8=CN=CN8)=O)C)=O)=O)=O)=O)=O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)=O)=O)CC%10=CC=CC=C%10)=O)=O)=O)CCSC)=O)=O)=O)=O)CC%11=CC=C(O)C=C%11
Formula	C262H403N79O76S3.XCF3COOH	M.Wt	5971.8
Solubility	Water: 1 mg/ml	Storage	Store at -20°C
General tips	Please select the appropriate solvent to prepare the stock solution according to the solubility of the product in different solvents; once the solution is prepared, please store it in separate packages to avoid product failure caused by repeated freezing and thawing.Storage method and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time.
Shipping Condition	Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request.

Complete Stock Solution Preparation Table

Prepare stock solution
		1 mg	5 mg	10 mg
	1 mM	0.1675 mL	0.8373 mL	1.6745 mL
	5 mM	0.0335 mL	0.1675 mL	0.3349 mL
	10 mM	0.0167 mL	0.0837 mL	0.1675 mL

Molarity Calculator
Dilution Calculator
Molecular Weight Calculator

Calculate

In vivo Formulation Calculator (Clear solution)

Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)

Dosage: mg/kg

Average weight of animals: g

Dosing volume per animal:μL

Number of animals:

Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)

% DMSO + % + % Tween 80 + % ddH₂O

%DMSO+ %

Calculation results:

Working concentration: mg/ml;

Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )

Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH₂O, mix and clarify.

Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.

Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.

Reseñas

Review for Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

Average Rating: 5 ★★★★★ (Based on Reviews and 5 reference(s) in Google Scholar.)

5 Star

100%

4 Star

3 Star

2 Star

1 Star

Review for Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.

Required fields are marked with *

Overall Rating

★

Review Title

Reseña

Apodo

Correo electrónico

You may receive emails regarding this submission. Any emails will include the ability to opt-out of future communications.

Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) (Synonyms: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge))

Reseñas de cliente

GlpBio Citations

Bioactive Compounds Premium Provider

GlpBio Products Cited In Reputable Papers

Product Documents

Quality Control & SDS

Complete Stock Solution Preparation Table

Molarity Calculator

Dilution Calculator

Molecular Weight Calculator

In vivo Formulation Calculator (Clear solution)

Reseñas

Adrenomedullin (1-52) (porcine) (trifluoroacetate salt) (Synonyms: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge))

Reseñas de cliente

GlpBio Citations

Bioactive Compounds Premium Provider

GlpBio Products Cited In Reputable Papers

Product Documents

Quality Control & SDS

Complete Stock Solution Preparation Table

Molarity Calculator

Dilution Calculator

Molecular Weight Calculator

In vivo Formulation Calculator (Clear solution)

Related Products

Reseñas