Dulaglutide (LY2189265) (Synonyms: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG) |
| Catalog No.GC31520 |
Dulaglutide (LY2189265) es un novedoso análogo de péptido 1 similar al glucagón (GLP-1) de acción prolongada para el tratamiento de la diabetes mellitus tipo 2 (T2DM).
Products are for research use only. Not for human use. We do not sell to patients.
Cas No.: 923950-08-7
Sample solution is provided at 25 µL, 10mM.
Dulaglutide (LY2189265) es un novedoso análogo de péptido 1 similar al glucagón (GLP-1) de acción prolongada para el tratamiento de la diabetes mellitus tipo 2 (T2DM) [1].
Dulaglutide (LY2189265) disminuyó significativamente la acumulación de lípidos hepáticos y redujo la expresión de genes asociados con las proteínas de unión a gotas de lípidos, la lipogénesis de novo y la síntesis de TG en células HepG2 tratadas con PA. Dulaglutide (LY2189265) también aumentó la expresión de proteínas asociadas con la lipólisis y la oxidación de ácidos grasos y FAM3A en células tratadas con PA [8]. Dulaglutide (LY2189265) promovió significativamente la fagocitosis de microglía para deshacerse de la placa de Aβ. Además, el tratamiento con Dulaglutide (LY2189265) inhibió la producción de factores proinflamatorios, incluyendo el factor de necrosis tumoral (TNF)-α, interleucina -1β e IL-6, mientras que aumentó la carga de moléculas antiinflamatorias como IL-10 afectadas por la exposición a Aβ1-42 [9].
La administración de Dulaglutide (LY2189265) atenuó el desgaste muscular y restauró la fuerza muscular al reducir la inflamación a través de la vía de señalización OPA-1-TLR-9 en los músculos tibial anterior (TA) y cuádriceps (QD) de ratones envejecidos [3]. Dulaglutide (LY2189265) puede reducir la hiperandrogenemia de las ratas con SOP regulando el contenido de SHBG en suero y la expresión de genes y proteínas relacionados con 3βHSD, CYP19α1 y StAR, inhibiendo así el desarrollo excesivo de folículos pequeños y la formación de folículos quísticos en los ovarios de ratas con SOP, mejorando así el ovario poliquístico en ratas con SOP [4]. Dulaglutide (LY2189265) mejora la capacidad de aprendizaje y memoria en ratones C57/BL6 machos de tipo salvaje de 9 semanas de edad (ratones AD) [2].
Después de la inyección subcutánea, Dulaglutide (LY2189265) se absorbió lentamente y el tmax en estado estacionario osciló entre 24 y 72 horas (mediana = 48 horas) [5, 6]. La biodisponibilidad absoluta fue del 47% y la vida media se estimó en 4,7 días. El estado estacionario se logró entre 2 y 4 semanas de dosificación y la relación de acumulación fue aproximadamente 1,56 [7].
References:
[1]:Jimenez-Solem E, Rasmussen MH, et,al. Dulaglutide, a long-acting GLP-1 analog fused with an Fc antibody fragment for the potential treatment of type 2 diabetes. Curr Opin Mol Ther. 2010 Dec;12(6):790-7. PMID: 21154170.
[2]: Jiang Guo-Jing, ZHOU Mei, et,al. Protective effects of dura glycopeptide on learning and memory loss and synaptic degeneration in AD mice [J]. Medical theory & practice,2021,34(14):2365-2368.
[3]: Khin PP, Hong Y, et,al. Dulaglutide improves muscle function by attenuating inflammation through OPA-1-TLR-9 signaling in aged mice. Aging (Albany NY). 2021 Sep 19;13(18):21962-21974. doi: 10.18632/aging.203546. Epub 2021 Sep 19. PMID: 34537761; PMCID: PMC8507261.
[4]: Wu LM, Wang YX, et,al. Dulaglutide, a long-acting GLP-1 receptor agonist, can improve hyperandrogenemia and ovarian function in DHEA-induced PCOS rats. Peptides. 2021 Nov;145:170624. doi: 10.1016/j.peptides.2021.170624. Epub 2021 Aug 8. PMID: 34375684.
[5]: Barrington P, Chien JY, et,al. A 5-week study of the pharmacokinetics and pharmacodynamics of LY2189265, a novel, long-acting glucagon-like peptide-1 analogue, in patients with type 2 diabetes. Diabetes Obes Metab. 2011 May;13(5):426-33. doi: 10.1111/j.1463-1326.2011.01364.x. Epub 2011 Jan 19. PMID: 21251178.
[6]: Barrington P, Chien JY, et,al. LY2189265, a long-acting glucagon-like peptide-1 analogue, showed a dose-dependent effect on insulin secretion in healthy subjects. Diabetes Obes Metab. 2011 May;13(5):434-8. doi: 10.1111/j.1463-1326.2011.01365.x. Epub 2011 Jan 19. PMID: 21251179.
[7]: Scheen AJ. Dulaglutide (LY-2189265) for the treatment of type 2 diabetes. Expert Rev Clin Pharmacol. 2016;9(3):385-99. doi: 10.1586/17512433.2016.1141046. Epub 2016 Feb 6. PMID: 26761217.
[8]: Lee J, Hong SW, et,al. Dulaglutide Ameliorates Palmitic Acid-Induced Hepatic Steatosis by Activating FAM3A Signaling Pathway. Endocrinol Metab (Seoul). 2022 Feb;37(1):74-83. doi: 10.3803/EnM.2021.1293. Epub 2022 Feb 9. PMID: 35144334; PMCID: PMC8901965.
[9]: Wang Y, Han B. Dulaglutide Alleviates Alzheimer's Disease by Regulating Microglial Polarization and Neurogenic Activity. Comb Chem High Throughput Screen. 2022 Jul 26. doi: 10.2174/1386207325666220726163514. Epub ahead of print. PMID: 35894460.
| Experimentos celulares [1]: | |
Líneas celulares | Células HepG2 |
Método de preparación | Las células HepG2 fueron pretratadas con 400 μM de ácido palmítico (PA) durante 24 horas, seguido de un tratamiento con o sin 100 nM de Dulaglutida (LY2189265) durante 24 horas. |
Condiciones de reacción | 100 nM de Dulaglutida (LY2189265) durante 24 horas. |
Áreas de aplicación | La Dulaglutida (LY2189265) disminuyó significativamente la acumulación de lípidos hepáticos y redujo la expresión de genes asociados con proteínas de unión a gotas lipídicas, lipogénesis de novo y síntesis de triglicéridos en células HepG2 tratadas con PA. La Dulaglutida (LY2189265) también aumentó la expresión de proteínas asociadas con la lipólisis y la oxidación de ácidos grasos, así como FAM3A en células tratadas con PA. |
| Experimentos con animales [2]: | |
Modelos animales | Ratones machos C57BL/6J jóvenes (4 meses) y viejos (24 meses) |
Método de preparación | A los ratones se les administró subcutáneamente 600 μg/kg/semana de Dulaglutida (LY2189265) durante 4 semanas. Se evaluaron diariamente el peso corporal y la ingesta de alimentos. Los ratones fueron pesados y sacrificados humanamente después de 4 semanas de tratamiento. |
Forma de dosificación | 600 μg/kg/semana de Dulaglutida (LY2189265) durante 4 semanas. |
Áreas de aplicación | La administración de Dulaglutida (LY2189265) atenuó la pérdida muscular y restauró la fuerza muscular al reducir la inflamación a través de la vía de señalización OPA-1-TLR-9 en los músculos tibial anterior (TA) y cuádriceps (QD) de ratones envejecidos. |
Referencias: [1]. Lee J, Hong SW, et al. Dulaglutide Ameliorates Palmitic Acid-Induced Hepatic Steatosis by Activating FAM3A Signaling Pathway. Endocrinol Metab (Seoul). 2022 Feb;37(1):74-83. doi: 10.3803/EnM.2021.1293. Epub 2022 Feb 9. PMID: 35144334; PMCID: PMC8901965. [2]. Khin PP, Hong Y, et al. Dulaglutide improves muscle function by attenuating inflammation through OPA-1-TLR-9 signaling in aged mice. Aging (Albany NY). 2021 Sep 19;13(18):21962-21974. doi: 10.18632/aging.203546. Epub 2021 Sep 19. PMID: 34537761; PMCID: PMC8507261. | |
| Cas No. | 923950-08-7 | SDF | |
| Sinónimos | HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG | ||
| Formula | C149H221N37O49 | M.Wt | 3314.62 |
| Solubility | > 40mg/mL in water | Storage | Store at -20°C |
| General tips | Please select the appropriate solvent to prepare the stock solution according to the
solubility of the product in different solvents; once the solution is prepared, please store it in
separate packages to avoid product failure caused by repeated freezing and thawing.Storage method
and period of the stock solution: When stored at -80°C, please use it within 6 months; when stored
at -20°C, please use it within 1 month. To increase solubility, heat the tube to 37°C and then oscillate in an ultrasonic bath for some time. |
||
| Shipping Condition | Evaluation sample solution: shipped with blue ice. All other sizes available: with RT, or with Blue Ice upon request. | ||
| Prepare stock solution | |||
|
1 mg | 5 mg | 10 mg |
| 1 mM | 0.3017 mL | 1.5085 mL | 3.0169 mL |
| 5 mM | 0.0603 mL | 0.3017 mL | 0.6034 mL |
| 10 mM | 0.0302 mL | 0.1508 mL | 0.3017 mL |
Step 1: Enter information below (Recommended: An additional animal making an allowance for loss during the experiment)
g
μL
Step 2: Enter the in vivo formulation (This is only the calculator, not formulation. Please contact us first if there is no in vivo formulation at the solubility Section.)
Calculation results:
Working concentration: mg/ml;
Method for preparing DMSO master liquid: mg drug pre-dissolved in μL DMSO ( Master liquid concentration mg/mL, Please contact us first if the concentration exceeds the DMSO solubility of the batch of drug. )
Method for preparing in vivo formulation: Take μL DMSO master liquid, next addμL PEG300, mix and clarify, next addμL Tween 80, mix and clarify, next add μL ddH2O, mix and clarify.
Method for preparing in vivo formulation: Take μL DMSO master liquid, next add μL Corn oil, mix and clarify.
Note: 1. Please make sure the liquid is clear before adding the next solvent.
2. Be sure to add the solvent(s) in order. You must ensure that the solution obtained, in the previous addition, is a clear solution before proceeding to add the next solvent. Physical methods such as vortex, ultrasound or hot water bath can be used to aid dissolving.
3. All of the above co-solvents are available for purchase on the GlpBio website.
Quality Control & SDS
- View current batch:
- Purity: >98.00%
- COA (Certificate Of Analysis)
- SDS (Safety Data Sheet)
- Datasheet
Average Rating: 5 (Based on Reviews and 22 reference(s) in Google Scholar.)
GLPBIO products are for RESEARCH USE ONLY. Please make sure your review or question is research based.
Required fields are marked with *